PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g20720.1.p
Common NameBRADI_4g20720, LOC100845720
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 881aa    MW: 97358.8 Da    PI: 5.9073
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g20720.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK932.1e-29538588252
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ek++sl++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Bradi4g20720.1.p 538 EKNVSLSVLQQYFAGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKIKKV 588
                       89***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.642525608IPR003035RWP-RK domain
PfamPF020429.0E-26540588IPR003035RWP-RK domain
SuperFamilySSF542771.08E-20775864No hitNo description
Gene3DG3DSA:3.10.20.2405.0E-21779861No hitNo description
SMARTSM006668.9E-19782864IPR000270PB1 domain
PROSITE profilePS5174523.964782864IPR000270PB1 domain
PfamPF005641.7E-16783863IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 881 aa     Download sequence    Send to blast
MDEIGTPNYS DGGSVPDMDL LMLSAFEGLD SFTELVAGPT FRDSILSSSS ISPVQQLLHI  60
SASSSTVNPE EQGDVSIADG SDCTASLASG EFMRMSTATV PRTVHGGVNL AERMLRALAM  120
LRKTSNGGPL LAQVWIPVRN GEHQVLSTSN QPFLLDERLT GYREVSKQFT FSATEGSGLF  180
PGLPGRVFIS GMPEWTSNVM YYNTSEYLRV DYAIRNEVRG SLAMPVFKSS GGTCCAVLEV  240
VMTQEKDNFC AEMDNLSNAL QSVHLSTVKA RAHPQSLTRS QESAFMEILD VLRAVCHEHT  300
LPLALAWVPV CPNSNLNVSA EYGDQAIKFG LRNTDVLCVQ ESACYISDTR MYDFVCACAE  360
HPLEKGQGVA GNAILSNNPF FSSDVREYNT HDYPLAHHAR KFGLHAAVAI RLRSTYTGND  420
DYVLEFFLPL MCRVKEEQQL LLDNLSVTMQ RVCSSLRTVS DAELEEDGIT KSSGIQCLPS  480
DISINSCIQI DASSAIKTNM PLENQIQSTV EQLVDQEHAN EFKQGTTSHG QKIRSSTEKN  540
VSLSVLQQYF AGSLKDAAKS IGVCPTTLKR ICRQHGISRW PSRKIKKVNR SLKKIHNVIS  600
SVHGVEAVIK YDPATGCLVS SVPPLEEPSM MNVEHRSSDP LSIEFDLSNR KFGHDYDAYR  660
REHVGKVVLT TAEYEKMSEI HITTNHGTLK GPLCQDASND SYITNQMTHV RTDMWVEGAE  720
RKNIVCNSVS MPQQFKMKKE TDKDNTNVDH SLPSTSSMTD YSSGVTSSDC PKSQPVNENS  780
MSITVKATYK EHNIRLKLLR SMKYQNLVEE IAKRLKLSAS TFQLKYKDDE DEWVILASDA  840
DLQECFEVLD NTDSHIVKVQ VRDVLFATGS SSGSSSTWCR *
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576097.20.0PREDICTED: protein NLP2-like
TrEMBLA0A0Q3EMH20.0A0A0Q3EMH2_BRADI; Uncharacterized protein
STRINGMLOC_13610.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36703573
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.20.0Nin-like family protein